SCOPe 2.01: Domain d2aiqa_: 2aiq A:

Lineage for d2aiqa_ (2aiq A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein automated matches [190044] (7 species)
   not a true protein

7. Species Agkistrodon contortrix [TaxId:8713] [187405] (2 PDB entries)

8. Domain d2aiqa_: 2aiq A: [162820]
   automated match to d1op2a_
   complexed with act, ben, cl, gol, nag, ndg, so4

Details for d2aiqa_

PDB Entry: 2aiq, 1.54 Å

PDB Description: crystal structure of benzamidine-inhibited protein c activator from the venom of copperhead snake agkistrodon contortrix contortrix

PDB Compounds: (A:) Protein C activator

SCOPe Domain Sequences for d2aiqa_:

Sequence; same for both SEQRES and ATOM records:

>d2aiqa_ b.47.1.2 (A:) automated matches {Agkistrodon contortrix [TaxId: 8713]}
viggdecninehrflalvyangslcggtlinqewvltarhcdrgnmriylgmhnlkvlnk
dalrrfpkekyfclntrndtiwdkdimlirlnrpvrnsahiaplslpsnppsvgsvcrim
gwgtitspnatlpdvphcaninildyavcqaaykglaattlcagileggkdtckgdsggp
licngqfqgilsvggnpcaqprkpgiytkvfdytdwiqsiisgntdatcpp

Timeline for d2aiqa_:

• d2aiqa_ is new in SCOPe 2.01-stable
  
• d2aiqa_ appears in SCOPe 2.02
  
• d2aiqa_ appears in the current release, SCOPe 2.08