SCOPe 2.06: Domain d2aiep_: 2aie P:

Lineage for d2aiep_ (2aie P:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
   automatically mapped to Pfam PF01327

6. Protein Peptide deformylase [56422] (11 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [90057] (8 PDB entries)

8. Domain d2aiep_: 2aie P: [162818]
   automated match to d1lm6a_
   complexed with ni, sb9, so4

Details for d2aiep_

PDB Entry: 2aie, 1.7 Å

PDB Description: S.pneumoniae polypeptide deformylase complexed with SB-505684

PDB Compounds: (P:) Peptide deformylase

SCOPe Domain Sequences for d2aiep_:

Sequence, based on SEQRES records:

>d2aiep_ d.167.1.1 (P:) Peptide deformylase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
saierivkaahlidmcdiiregnpslrtvaeevtfplsdqeiilgekmmqflkhsqdpvm
aekmglrggvglaapqldiskriiavlvpniveegetpqeaydleaimynpkivshsvqd
aalgegegclsvdrnvpgyvvrharvtvdyfdkdgekhriklkgynsivvqheidhingi
mfydrinekdpfavkdgllile

Sequence, based on observed residues (ATOM records):

>d2aiep_ d.167.1.1 (P:) Peptide deformylase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
saierivkaahlidmcdiiregnpslrtvaeevtfplsdqeiilgekmmqflkhsqdpvm
aekmglrggvglaapqldiskriiavlvpnieaydleaimynpkivshsvqdaalgegeg
clsvdrnvpgyvvrharvtvdyfdkdgekhriklkgynsivvqheidhingimfydrine
kdpfavkdgllile

Timeline for d2aiep_:

• d2aiep_ first appeared in SCOPe 2.01
  
• d2aiep_ appears in SCOPe 2.05
  
• d2aiep_ appears in SCOPe 2.07
  
• d2aiep_ appears in the current release, SCOPe 2.08