![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
![]() | Superfamily d.167.1: Peptide deformylase [56420] (2 families) ![]() nickel-dependent enzyme |
![]() | Family d.167.1.1: Peptide deformylase [56421] (2 proteins) automatically mapped to Pfam PF01327 |
![]() | Protein Peptide deformylase [56422] (11 species) |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [90057] (10 PDB entries) |
![]() | Domain d2aiep_: 2aie P: [162818] automated match to d1lm6a_ complexed with ni, sb9, so4 |
PDB Entry: 2aie (more details), 1.7 Å
SCOPe Domain Sequences for d2aiep_:
Sequence, based on SEQRES records: (download)
>d2aiep_ d.167.1.1 (P:) Peptide deformylase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} saierivkaahlidmcdiiregnpslrtvaeevtfplsdqeiilgekmmqflkhsqdpvm aekmglrggvglaapqldiskriiavlvpniveegetpqeaydleaimynpkivshsvqd aalgegegclsvdrnvpgyvvrharvtvdyfdkdgekhriklkgynsivvqheidhingi mfydrinekdpfavkdgllile
>d2aiep_ d.167.1.1 (P:) Peptide deformylase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} saierivkaahlidmcdiiregnpslrtvaeevtfplsdqeiilgekmmqflkhsqdpvm aekmglrggvglaapqldiskriiavlvpnieaydleaimynpkivshsvqdaalgegeg clsvdrnvpgyvvrharvtvdyfdkdgekhriklkgynsivvqheidhingimfydrine kdpfavkdgllile
Timeline for d2aiep_: