![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
![]() | Superfamily d.167.1: Peptide deformylase [56420] (2 families) ![]() nickel-dependent enzyme |
![]() | Family d.167.1.1: Peptide deformylase [56421] (2 proteins) |
![]() | Protein Peptide deformylase [56422] (10 species) |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [90057] (7 PDB entries) |
![]() | Domain d2ai7a_: 2ai7 A: [162816] automated match to d1lm6a_ complexed with ni, sb7, so4 |
PDB Entry: 2ai7 (more details), 2 Å
SCOPe Domain Sequences for d2ai7a_:
Sequence, based on SEQRES records: (download)
>d2ai7a_ d.167.1.1 (A:) Peptide deformylase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} saieriskaahlidmcdiiregnpslrtvaeevtfplsdqeiilgekmmqflkhsqdpvm aekmglrggvglaapqldiskriiavlvpniveegetpqeaydleaimynpkivshsvqd aalgegegclsvdrnvpgyvvrharvtvdyfdkdgekhriklkgynsivvqheidhingi mfydrinekdpfavkdgllile
>d2ai7a_ d.167.1.1 (A:) Peptide deformylase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} saieriskaahlidmcdiiregnpslrtvaeevtfplsdqeiilgekmmqflkhsqdpvm aekmglrggvglaapqldiskriiavlvpnieaydleaimynpkivshsvqdaalgegeg clsvdrnvpgyvvrharvtvdyfdkdgekhriklkgynsivvqheidhingimfydrine kdpfavkdgllile
Timeline for d2ai7a_: