Lineage for d2ahgb_ (2ahg B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276656Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1276657Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 1276824Family a.102.1.7: Glycosyl Hydrolase Family 88 [109953] (2 proteins)
    Pfam PF07470
  6. 1276833Protein automated matches [190261] (1 species)
    not a true protein
  7. 1276834Species Bacillus sp. [TaxId:84635] [187050] (3 PDB entries)
  8. 1276840Domain d2ahgb_: 2ahg B: [162812]
    automated match to d1vd5a_
    complexed with ucd; mutant

Details for d2ahgb_

PDB Entry: 2ahg (more details), 1.9 Å

PDB Description: unsaturated glucuronyl hydrolase mutant d88n with dglca-galnac
PDB Compounds: (B:) unsaturated glucuronyl hydrolase

SCOPe Domain Sequences for d2ahgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ahgb_ a.102.1.7 (B:) automated matches {Bacillus sp. [TaxId: 84635]}
mwqqaigdalgitarnlkkfgdrfphvsdgsnkyvlndntdwtdgfwsgilwlcyeytgd
eqyregavrtvasfrerldrfenldhhnigflyslsakaqwivekdesarklaldaadvl
mrrwradagiiqawgpkgdpenggriiidcllnlplllwageqtgdpeyrrvaeahalks
rrflvrgddssyhtfyfdpengnairggthqgntdgstwtrgqawgiygfalnsrylgna
dlletakrmarhflarvpedgvvywdfevpqepssyrdssasaitacglleiasqldesd
perqrfidaakttvtalrdgyaerddgeaegfirrgsyhvrggispddytiwgdyyylea
llrlergvtgywyergr

SCOPe Domain Coordinates for d2ahgb_:

Click to download the PDB-style file with coordinates for d2ahgb_.
(The format of our PDB-style files is described here.)

Timeline for d2ahgb_: