Lineage for d2ahga_ (2ahg A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004235Family a.102.1.7: Glycosyl Hydrolase Family 88 [109953] (2 protein domains)
    Pfam PF07470
  6. 2004244Protein automated matches [190261] (1 species)
    not a true protein
  7. 2004245Species Bacillus sp. [TaxId:84635] [187050] (3 PDB entries)
  8. 2004250Domain d2ahga_: 2ahg A: [162811]
    automated match to d1vd5a_
    complexed with ucd; mutant

Details for d2ahga_

PDB Entry: 2ahg (more details), 1.9 Å

PDB Description: Unsaturated glucuronyl hydrolase mutant D88N with dGlcA-GalNAc
PDB Compounds: (A:) unsaturated glucuronyl hydrolase

SCOPe Domain Sequences for d2ahga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ahga_ a.102.1.7 (A:) automated matches {Bacillus sp. [TaxId: 84635]}
mwqqaigdalgitarnlkkfgdrfphvsdgsnkyvlndntdwtdgfwsgilwlcyeytgd
eqyregavrtvasfrerldrfenldhhnigflyslsakaqwivekdesarklaldaadvl
mrrwradagiiqawgpkgdpenggriiidcllnlplllwageqtgdpeyrrvaeahalks
rrflvrgddssyhtfyfdpengnairggthqgntdgstwtrgqawgiygfalnsrylgna
dlletakrmarhflarvpedgvvywdfevpqepssyrdssasaitacglleiasqldesd
perqrfidaakttvtalrdgyaerddgeaegfirrgsyhvrggispddytiwgdyyylea
llrlergvtgywyergr

SCOPe Domain Coordinates for d2ahga_:

Click to download the PDB-style file with coordinates for d2ahga_.
(The format of our PDB-style files is described here.)

Timeline for d2ahga_: