SCOPe 2.08: Domain d2ahab_: 2aha B:

Lineage for d2ahab_ (2aha B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (6 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries)
   Uniprot P42212

8. Domain d2ahab_: 2aha B: [162808]
   automated match to d1jc1a_
   complexed with so4

Details for d2ahab_

PDB Entry: 2aha, 1.98 Å

PDB Description: crystal structure analysis of a rate-enhanced variant of redox- sensitive green fluorescent protein in the reduced form, rogfp1-r8.

PDB Compounds: (B:) Green fluorescent protein

SCOPe Domain Sequences for d2ahab_:

Sequence; same for both SEQRES and ATOM records:

>d2ahab_ d.22.1.1 (B:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygdltlkfisttgklpvpwptlv
ttfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynchnvyimadkqkngikvnfkirhniedgsvqladh
yqqntpigdgpvllpdnhylstcsalskdpnekrdhmvllervtaagi

Timeline for d2ahab_:

• d2ahab_ first appeared in SCOPe 2.01
  
• d2ahab_ appears in SCOPe 2.07