Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (2 proteins) |
Protein automated matches [190297] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187395] (19 PDB entries) |
Domain d2ah9c_: 2ah9 C: [162806] automated match to d1tvya_ complexed with dio, gol, mes, mn, so4, udh |
PDB Entry: 2ah9 (more details), 2 Å
SCOPe Domain Sequences for d2ah9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ah9c_ c.68.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lpacpeespllvgpmliefnmpvdlelvakqnpnvkmggryaprdcvsphkvaiiipfrn rqehlkywlyylhpvlqrqqldygiyvinqagdtifnrakllnvgfqealkdydytcfvf sdvdlipmndhnayrcfsqprhisvamdkfgfslpyvqyfggvsalskqqfltingfpnn ywgwggedddifnrlvfrgmsisrpnavvgttrhirhsrdkknepnpqrfdriahtketm lsdglnsltyqvldvqryplytqitvdigtps
Timeline for d2ah9c_: