Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site |
Family a.25.2.2: Cobalamin adenosyltransferase [89032] (3 proteins) |
Protein automated matches [190476] (1 species) not a true protein |
Species Bacillus halodurans [TaxId:272558] [187401] (1 PDB entry) |
Domain d2ah6a_: 2ah6 A: [162799] automated match to d1rtyb_ complexed with edo, no3 |
PDB Entry: 2ah6 (more details), 1.6 Å
SCOPe Domain Sequences for d2ah6a_:
Sequence, based on SEQRES records: (download)
>d2ah6a_ a.25.2.2 (A:) automated matches {Bacillus halodurans [TaxId: 272558]} dtrvvaygttdelnsfvgsaitqldentfadirgelfkiqhelfdcggdlamlkvkedrp ykakqeivdfleqridayikeapelerfilpggseaaaslhvcrtiarraeryvvrlqqe geinpivlkylnrlsdyffavarvvnsrlqvpdveye
>d2ah6a_ a.25.2.2 (A:) automated matches {Bacillus halodurans [TaxId: 272558]} dtrvvaygttdelnsfvgsaitqldentfadirgelfkiqhelfdcggdlamlpykakqe ivdfleqridayikeapelerfilpggseaaaslhvcrtiarraeryvvrlqqegeinpi vlkylnrlsdyffavarvvnsrlqvpdveye
Timeline for d2ah6a_: