SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2ah6a_ (2ah6 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1991265Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) (S)
    crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site
  5. 1991270Family a.25.2.2: Cobalamin adenosyltransferase [89032] (3 protein domains)
    automatically mapped to Pfam PF01923
  6. 1991279Protein automated matches [190476] (1 species)
    not a true protein
  7. 1991280Species Bacillus halodurans [TaxId:272558] [187401] (1 PDB entry)
  8. 1991281Domain d2ah6a_: 2ah6 A: [162799]
    automated match to d1rtyb_
    complexed with edo, no3

Details for d2ah6a_

PDB Entry: 2ah6 (more details), 1.6 Å

PDB Description: Crystal structure of a putative cobalamin adenosyltransferase (bh1595) from bacillus halodurans c-125 at 1.60 A resolution
PDB Compounds: (A:) BH1595, unknown conserved protein

SCOPe Domain Sequences for d2ah6a_:

Sequence, based on SEQRES records: (download)

>d2ah6a_ a.25.2.2 (A:) automated matches {Bacillus halodurans [TaxId: 272558]}
dtrvvaygttdelnsfvgsaitqldentfadirgelfkiqhelfdcggdlamlkvkedrp
ykakqeivdfleqridayikeapelerfilpggseaaaslhvcrtiarraeryvvrlqqe
geinpivlkylnrlsdyffavarvvnsrlqvpdveye

Sequence, based on observed residues (ATOM records): (download)

>d2ah6a_ a.25.2.2 (A:) automated matches {Bacillus halodurans [TaxId: 272558]}
dtrvvaygttdelnsfvgsaitqldentfadirgelfkiqhelfdcggdlamlpykakqe
ivdfleqridayikeapelerfilpggseaaaslhvcrtiarraeryvvrlqqegeinpi
vlkylnrlsdyffavarvvnsrlqvpdveye

SCOPe Domain Coordinates for d2ah6a_:

Click to download the PDB-style file with coordinates for d2ah6a_.
(The format of our PDB-style files is described here.)

Timeline for d2ah6a_: