Lineage for d1bdxc1 (1bdx C:156-203)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1765Fold a.5: RuvA C-terminal domain-like [46928] (6 superfamilies)
  4. 1766Superfamily a.5.1: DNA helicase RuvA subunit, C-terminal domain [46929] (1 family) (S)
  5. 1767Family a.5.1.1: DNA helicase RuvA subunit, C-terminal domain [46930] (1 protein)
  6. 1768Protein DNA helicase RuvA subunit, C-terminal domain [46931] (2 species)
  7. 1769Species Escherichia coli [TaxId:562] [46932] (4 PDB entries)
  8. 1775Domain d1bdxc1: 1bdx C:156-203 [16278]
    Other proteins in same PDB: d1bdxa2, d1bdxa3, d1bdxb2, d1bdxb3, d1bdxc2, d1bdxc3, d1bdxd2, d1bdxd3

Details for d1bdxc1

PDB Entry: 1bdx (more details), 6 Å

PDB Description: e. coli dna helicase ruva with bound dna holliday junction, alpha carbons and phosphate atoms only
PDB Compounds: (C:) holliday junction DNA helicase ruva

SCOP Domain Sequences for d1bdxc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdxc1 a.5.1.1 (C:156-203) DNA helicase RuvA subunit, C-terminal domain {Escherichia coli}
tddaeqeavaalvalgykpqeasrmvskiarpdassetlirealraal

SCOP Domain Coordinates for d1bdxc1:

Click to download the PDB-style file with coordinates for d1bdxc1.
(The format of our PDB-style files is described here.)

Timeline for d1bdxc1: