SCOPe 2.02: Domain d2af0a_: 2af0 A:

Lineage for d2af0a_ (2af0 A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.0: automated matches [191379] (1 protein)
   not a true family

6. Protein automated matches [190464] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187381] (5 PDB entries)

8. Domain d2af0a_: 2af0 A: [162776]
   automated match to d2jm5a1

Details for d2af0a_

PDB Entry: 2af0, 2.3 Å

PDB Description: Structure of the Regulator of G-Protein Signaling Domain of RGS2

PDB Compounds: (A:) Regulator of G-protein signaling 2

SCOPe Domain Sequences for d2af0a_:

Sequence; same for both SEQRES and ATOM records:

>d2af0a_ a.91.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adlgtenlyfqsmkpspeeaqlwseafdellaskyglaafraflksefceeniefwlace
dfkktkspqklsskarkiytdfiekeapkeinidfqtktliaqniqeatsgcfttaqkrv
yslmennsyprflesefyqdlckkpq

Timeline for d2af0a_:

• d2af0a_ first appeared in SCOPe 2.01
  
• d2af0a_ appears in SCOPe 2.03
  
• d2af0a_ appears in the current release, SCOPe 2.08, called d2af0a1