| Class b: All beta proteins [48724] (178 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
| Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
| Protein automated matches [190437] (66 species) not a true protein |
| Species Rotavirus a [TaxId:10941] [187397] (2 PDB entries) |
| Domain d2aenh_: 2aen H: [162772] automated match to d1kqra_ complexed with eoh, gol |
PDB Entry: 2aen (more details), 1.6 Å
SCOPe Domain Sequences for d2aenh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aenh_ b.29.1.0 (H:) automated matches {Rotavirus a [TaxId: 10941]}
tvepvldgpyqpttfkppndywllissntngvvyestnnndfwtaviavephvsqtnrqy
ilfgenkqfnvennsdkwkffemfkgssqgdfsnrrtltssnrlvgmlkyggrvwtfhge
tprattdssntadlnnisiiihsefyiiprsqeskcneyinngl
Timeline for d2aenh_: