![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (23 species) not a true protein |
![]() | Species Rotavirus a [TaxId:10941] [187397] (1 PDB entry) |
![]() | Domain d2aenf_: 2aen F: [162770] automated match to d1kqra_ complexed with eoh, gol |
PDB Entry: 2aen (more details), 1.6 Å
SCOPe Domain Sequences for d2aenf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aenf_ b.29.1.0 (F:) automated matches {Rotavirus a [TaxId: 10941]} tvepvldgpyqpttfkppndywllissntngvvyestnnndfwtaviavephvsqtnrqy ilfgenkqfnvennsdkwkffemfkgssqgdfsnrrtltssnrlvgmlkyggrvwtfhge tprattdssntadlnnisiiihsefyiiprsqeskcneyinngl
Timeline for d2aenf_: