Lineage for d2aene_ (2aen E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390272Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2390273Protein automated matches [190437] (66 species)
    not a true protein
  7. 2390931Species Rotavirus a [TaxId:10941] [187397] (2 PDB entries)
  8. 2390937Domain d2aene_: 2aen E: [162769]
    automated match to d1kqra_
    complexed with eoh, gol

Details for d2aene_

PDB Entry: 2aen (more details), 1.6 Å

PDB Description: crystal structure of the rotavirus strain ds-1 vp8* core
PDB Compounds: (E:) Outer capsid protein VP4, VP8* core

SCOPe Domain Sequences for d2aene_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aene_ b.29.1.0 (E:) automated matches {Rotavirus a [TaxId: 10941]}
tvepvldgpyqpttfkppndywllissntngvvyestnnndfwtaviavephvsqtnrqy
ilfgenkqfnvennsdkwkffemfkgssqgdfsnrrtltssnrlvgmlkyggrvwtfhge
tprattdssntadlnnisiiihsefyiiprsqeskcneyinngl

SCOPe Domain Coordinates for d2aene_:

Click to download the PDB-style file with coordinates for d2aene_.
(The format of our PDB-style files is described here.)

Timeline for d2aene_: