Lineage for d2aend_ (2aen D:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1118105Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1118106Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1119701Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1119702Protein automated matches [190437] (13 species)
    not a true protein
  7. 1119797Species Rotavirus a [TaxId:10941] [187397] (1 PDB entry)
  8. 1119801Domain d2aend_: 2aen D: [162768]
    automated match to d1kqra_
    complexed with eoh, gol

Details for d2aend_

PDB Entry: 2aen (more details), 1.6 Å

PDB Description: crystal structure of the rotavirus strain ds-1 vp8* core
PDB Compounds: (D:) Outer capsid protein VP4, VP8* core

SCOPe Domain Sequences for d2aend_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aend_ b.29.1.0 (D:) automated matches {Rotavirus a [TaxId: 10941]}
tvepvldgpyqpttfkppndywllissntngvvyestnnndfwtaviavephvsqtnrqy
ilfgenkqfnvennsdkwkffemfkgssqgdfsnrrtltssnrlvgmlkyggrvwtfhge
tprattdssntadlnnisiiihsefyiiprsqeskcneyinngl

SCOPe Domain Coordinates for d2aend_:

Click to download the PDB-style file with coordinates for d2aend_.
(The format of our PDB-style files is described here.)

Timeline for d2aend_: