Lineage for d2ad1a_ (2ad1 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109901Family c.37.1.5: PAPS sulfotransferase [52575] (15 protein domains)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 2109987Protein automated matches [190189] (4 species)
    not a true protein
  7. 2109995Species Human (Homo sapiens) [TaxId:9606] [186928] (11 PDB entries)
  8. 2110001Domain d2ad1a_: 2ad1 A: [162758]
    automated match to d3bfxa1

Details for d2ad1a_

PDB Entry: 2ad1 (more details), 2 Å

PDB Description: Human Sulfotransferase SULT1C2
PDB Compounds: (A:) Sulfotransferase 1C2

SCOPe Domain Sequences for d2ad1a_:

Sequence, based on SEQRES records: (download)

>d2ad1a_ c.37.1.5 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tkrlsvnyvkgilqptdtcdiwdkiwnfqakpddllistypkagttwtqeiveliqnegd
vekskrapthqrfpflemkipslgsgleqahampsprilkthlpfhllppslleknckii
yvarnpkdnmvsyyhfqrmnkalpapgtweeyfetflagkvcwgswhehvkgwweakdkh
rilylfyedmkknpkheiqklaefigkklddkvldkivhytsfdvmkqnpmanyssipae
imdhsispfmrkgavgdwkkhftvaqnerfdedykkkmtdtrltfhf

Sequence, based on observed residues (ATOM records): (download)

>d2ad1a_ c.37.1.5 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tkrlsvnyvkgilqptdtcdiwdkiwnfqakpddllistypkagttwtqeiveliqnegd
vekskrfpflemkisgleqahampsprilkthlpfhllppslleknckiiyvarnpkdnm
vsyyhfqrmnkalpapgtweeyfetflagkvcwgswhehvkgwweakdkhrilylfyedm
kknpkheiqklaefigkklddkvldkivhytvgdwkkhftvaqnerfdedykkkmtdtrl
tfhf

SCOPe Domain Coordinates for d2ad1a_:

Click to download the PDB-style file with coordinates for d2ad1a_.
(The format of our PDB-style files is described here.)

Timeline for d2ad1a_: