SCOPe 2.06: Domain d2acob1: 2aco B:11-175

Lineage for d2acob1 (2aco B:11-175)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein automated matches [190163] (13 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187394] (1 PDB entry)

8. Domain d2acob1: 2aco B:11-175 [162757]
   Other proteins in same PDB: d2acoa2, d2acob2
   automated match to d1qwda_
   complexed with vca

Details for d2acob1

PDB Entry: 2aco, 1.8 Å

PDB Description: Xray structure of Blc dimer in complex with vaccenic acid

PDB Compounds: (B:) Outer membrane lipoprotein blc

SCOPe Domain Sequences for d2acob1:

Sequence; same for both SEQRES and ATOM records:

>d2acob1 b.60.1.1 (B:11-175) automated matches {Escherichia coli [TaxId: 562]}
lestslykkagstpprgvtvvnnfdakrylgtwyeiarfdhrferglekvtatyslrddg
glnvinkgynpdrgmwqqsegkayftgaptraalkvsffgpfyggynvialdreyrhalv
cgpdrdylwilsrtptisdevkqemlavatregfdvskfiwvqqp

Timeline for d2acob1:

• d2acob1 first appeared in SCOPe 2.01, called d2acob_
  
• d2acob1 was called d2acob_ in SCOPe 2.05
  
• d2acob1 appears in SCOPe 2.07
  
• d2acob1 appears in the current release, SCOPe 2.08