![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily) 2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8 |
![]() | Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) ![]() |
![]() | Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (4 proteins) |
![]() | Protein automated matches [190187] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186926] (6 PDB entries) |
![]() | Domain d2abjj_: 2abj J: [162753] automated match to d1ekfa_ complexed with cbc, plp |
PDB Entry: 2abj (more details), 2.2 Å
SCOPe Domain Sequences for d2abjj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2abjj_ e.17.1.1 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vvgtfkakdlivtpatilkekpdpnnlvfgtvftdhmltvewssefgwekphikplqnls lhpgssalhyavelfeglkafrgvdnkirlfqpnlnmdrmyrsavratlpvfdkeellec iqqlvkldqewvpystsaslyirpafigtepslgvkkptkallfvllspvgpyfssgtfn pvslwanpkyvrawkggtgdckmggnygsslfaqcedvdngcqqvlwlygrdhqitevgt mnlflywinedgeeelatppldgiilpgvtrrcildlahqwgefkvseryltmddlttal egnrvremfssgtacvvcpvsdilykgetihiptmengpklasrilskltdiqygreesd wtivls
Timeline for d2abjj_: