Lineage for d2abjd_ (2abj D:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1056766Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 1056767Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 1056768Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (4 proteins)
  6. 1056834Protein automated matches [190187] (1 species)
    not a true protein
  7. 1056835Species Human (Homo sapiens) [TaxId:9606] [186926] (3 PDB entries)
  8. 1056839Domain d2abjd_: 2abj D: [162751]
    automated match to d1ekfa_
    complexed with cbc, plp

Details for d2abjd_

PDB Entry: 2abj (more details), 2.2 Å

PDB Description: crystal structure of human branched chain amino acid transaminase in a complex with an inhibitor, c16h10n2o4f3scl, and pyridoxal 5' phosphate.
PDB Compounds: (D:) Branched-chain-amino-acid aminotransferase, cytosolic

SCOPe Domain Sequences for d2abjd_:

Sequence, based on SEQRES records: (download)

>d2abjd_ e.17.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vvgtfkakdlivtpatilkekpdpnnlvfgtvftdhmltvewssefgwekphikplqnls
lhpgssalhyavelfeglkafrgvdnkirlfqpnlnmdrmyrsavratlpvfdkeellec
iqqlvkldqewvpystsaslyirpafigtepslgvkkptkallfvllspvgpyfssgtfn
pvslwanpkyvrawkggtgdckmggnygsslfaqcedvdngcqqvlwlygrdhqitevgt
mnlflywinedgeeelatppldgiilpgvtrrcildlahqwgefkvseryltmddlttal
egnrvremfssgtacvvcpvsdilykgetihiptmengpklasrilskltdiqygreesd
wtivl

Sequence, based on observed residues (ATOM records): (download)

>d2abjd_ e.17.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vvgtfkakdlivtpatilkekpdpnnlvfgtvftdhmltvewssefgwekphikplqnls
lhpgssalhyavelfeglkafrgvdnkirlfqpnlnmdrmyrsavratlpvfdkeellec
iqqlvkldqewvpystsaslyirpafigtepslgvkkptkallfvllspvgpfnpvslwa
npkyvrawkggtgdckmggnygsslfaqcedvdngcqqvlwlygrdhqitevgtmnlfly
winedgeeelatppldgiilpgvtrrcildlahqwgefkvseryltmddlttalegnrvr
emfssgtacvvcpvsdilykgetihiptmengpklasrilskltdiqygreesdwtivl

SCOPe Domain Coordinates for d2abjd_:

Click to download the PDB-style file with coordinates for d2abjd_.
(The format of our PDB-style files is described here.)

Timeline for d2abjd_: