Lineage for d2abja_ (2abj A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3018494Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 3018495Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 3018496Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (4 proteins)
  6. 3018595Protein automated matches [190187] (2 species)
    not a true protein
  7. 3018596Species Human (Homo sapiens) [TaxId:9606] [186926] (6 PDB entries)
  8. 3018605Domain d2abja_: 2abj A: [162750]
    automated match to d1ekfa_
    complexed with cbc, plp

Details for d2abja_

PDB Entry: 2abj (more details), 2.2 Å

PDB Description: crystal structure of human branched chain amino acid transaminase in a complex with an inhibitor, c16h10n2o4f3scl, and pyridoxal 5' phosphate.
PDB Compounds: (A:) Branched-chain-amino-acid aminotransferase, cytosolic

SCOPe Domain Sequences for d2abja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2abja_ e.17.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vvgtfkakdlivtpatilkekpdpnnlvfgtvftdhmltvewssefgwekphikplqnls
lhpgssalhyavelfeglkafrgvdnkirlfqpnlnmdrmyrsavratlpvfdkeellec
iqqlvkldqewvpystsaslyirpafigtepslgvkkptkallfvllspvgpyfssgtfn
pvslwanpkyvrawkggtgdckmggnygsslfaqcedvdngcqqvlwlygrdhqitevgt
mnlflywinedgeeelatppldgiilpgvtrrcildlahqwgefkvseryltmddlttal
egnrvremfssgtacvvcpvsdilykgetihiptmengpklasrilskltdiqygreesd
wtivls

SCOPe Domain Coordinates for d2abja_:

Click to download the PDB-style file with coordinates for d2abja_.
(The format of our PDB-style files is described here.)

Timeline for d2abja_: