Lineage for d1c7ya1 (1c7y A:155-203)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1765Fold a.5: RuvA C-terminal domain-like [46928] (6 superfamilies)
  4. 1766Superfamily a.5.1: DNA helicase RuvA subunit, C-terminal domain [46929] (1 family) (S)
  5. 1767Family a.5.1.1: DNA helicase RuvA subunit, C-terminal domain [46930] (1 protein)
  6. 1768Protein DNA helicase RuvA subunit, C-terminal domain [46931] (2 species)
  7. 1769Species Escherichia coli [TaxId:562] [46932] (4 PDB entries)
  8. 1772Domain d1c7ya1: 1c7y A:155-203 [16275]
    Other proteins in same PDB: d1c7ya2, d1c7ya3

Details for d1c7ya1

PDB Entry: 1c7y (more details), 3.1 Å

PDB Description: e.coli ruva-holliday junction complex

SCOP Domain Sequences for d1c7ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7ya1 a.5.1.1 (A:155-203) DNA helicase RuvA subunit, C-terminal domain {Escherichia coli}
atddaeqeavaalvalgykpqeasrmvskiarpdassetlirealraal

SCOP Domain Coordinates for d1c7ya1:

Click to download the PDB-style file with coordinates for d1c7ya1.
(The format of our PDB-style files is described here.)

Timeline for d1c7ya1: