SCOPe 2.06: Domain d1hjpa1: 1hjp A:158-203

Lineage for d1hjpa1 (1hjp A:158-203)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.1: DNA helicase RuvA subunit, C-terminal domain [46929] (1 family)
   possibly related to UBA-like domains

5. Family a.5.1.1: DNA helicase RuvA subunit, C-terminal domain [46930] (1 protein)

6. Protein DNA helicase RuvA subunit, C-terminal domain [46931] (3 species)
   tetramer; binds Holliday junction

7. Species Escherichia coli [TaxId:562] [46932] (4 PDB entries)

8. Domain d1hjpa1: 1hjp A:158-203 [16274]
   Other proteins in same PDB: d1hjpa2, d1hjpa3

Details for d1hjpa1

PDB Entry: 1hjp, 2.5 Å

PDB Description: holliday junction binding protein ruva from e. coli

PDB Compounds: (A:) ruva

SCOPe Domain Sequences for d1hjpa1:

Sequence; same for both SEQRES and ATOM records:

>d1hjpa1 a.5.1.1 (A:158-203) DNA helicase RuvA subunit, C-terminal domain {Escherichia coli [TaxId: 562]}
daeqeavaalvalgykpqeasrmvskiarpdassetlirealraal

Timeline for d1hjpa1:

• d1hjpa1 first appeared (with stable ids) in SCOP 1.55, called d1hjp_1
  
• d1hjpa1 appears in SCOPe 2.05
  
• d1hjpa1 appears in SCOPe 2.07
  
• d1hjpa1 appears in the current release, SCOPe 2.08