Lineage for d2aazg_ (2aaz G:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1038908Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1038909Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) (S)
  5. 1038910Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 1039145Protein automated matches [190469] (5 species)
    not a true protein
  7. 1039148Species Fungus (Filobasidiella neoformans) [TaxId:5207] [187389] (1 PDB entry)
  8. 1039155Domain d2aazg_: 2aaz G: [162737]
    automated match to d1ci7a_
    complexed with cb3, ump

Details for d2aazg_

PDB Entry: 2aaz (more details), 2.08 Å

PDB Description: cryptococcus neoformans thymidylate synthase complexed with substrate and an antifolate
PDB Compounds: (G:) Thymidylate synthase

SCOPe Domain Sequences for d2aazg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aazg_ d.117.1.1 (G:) automated matches {Fungus (Filobasidiella neoformans) [TaxId: 5207]}
rsnpdheeyqyldlirriinvgevrpdrtgtgtvalfappsfrfsladntlpllttkrvf
lrgviaellwfvsgctdakmlssqgvgiwdgngskeflekvglghrregdlgpvygfqwr
hfgaeytdadgdykgkgvdqlqrvidtiknnptdrriilsawnpkdlplmalppchmfcq
ffvslppadspgskpklsclmyqrscdlglgvpfniasyallthmialitdtephefilq
mgdahvyrdhveplktqlereprdfpklkwarskeeigdidgfkvedfvvegykpwgkid
mkmsa

SCOPe Domain Coordinates for d2aazg_:

Click to download the PDB-style file with coordinates for d2aazg_.
(The format of our PDB-style files is described here.)

Timeline for d2aazg_: