Lineage for d2aazf_ (2aaz F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972108Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2972109Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2972110Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2972567Protein automated matches [190469] (17 species)
    not a true protein
  7. 2972615Species Fungus (Filobasidiella neoformans) [TaxId:5207] [187389] (1 PDB entry)
  8. 2972621Domain d2aazf_: 2aaz F: [162736]
    automated match to d1ci7a_
    complexed with cb3, ump

Details for d2aazf_

PDB Entry: 2aaz (more details), 2.08 Å

PDB Description: cryptococcus neoformans thymidylate synthase complexed with substrate and an antifolate
PDB Compounds: (F:) Thymidylate synthase

SCOPe Domain Sequences for d2aazf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aazf_ d.117.1.1 (F:) automated matches {Fungus (Filobasidiella neoformans) [TaxId: 5207]}
rsnpdheeyqyldlirriinvgevrpdrtgtgtvalfappsfrfsladntlpllttkrvf
lrgviaellwfvsgctdakmlssqgvgiwdgngskeflekvglghrregdlgpvygfqwr
hfgaeytdadgdykgkgvdqlqrvidtiknnptdrriilsawnpkdlplmalppchmfcq
ffvslppadspgskpklsclmyqrscdlglgvpfniasyallthmialitdtephefilq
mgdahvyrdhveplktqlereprdfpklkwarskeeigdidgfkvedfvvegykpwgkid
mkmsa

SCOPe Domain Coordinates for d2aazf_:

Click to download the PDB-style file with coordinates for d2aazf_.
(The format of our PDB-style files is described here.)

Timeline for d2aazf_: