![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.77: DEATH domain [47985] (1 superfamily) 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry |
![]() | Superfamily a.77.1: DEATH domain [47986] (5 families) ![]() |
![]() | Family a.77.1.2: DEATH domain, DD [81312] (9 proteins) Pfam PF00531 |
![]() | Protein automated matches [190466] (3 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [187386] (1 PDB entry) |
![]() | Domain d2a9ia_: 2a9i A: [162730] automated match to d1wh4a_ complexed with mn |
PDB Entry: 2a9i (more details), 1.7 Å
SCOPe Domain Sequences for d2a9ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a9ia_ a.77.1.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} kpltpstyirnlnvgilrklsdfidpqegwkklavaikkpsgddrynqfhirrfeallqt glsptcellfdwgttnctvgdlvdllvqielfapatlllpdavpq
Timeline for d2a9ia_: