Lineage for d2a9ia_ (2a9i A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718930Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2718931Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2718932Family a.77.1.2: DEATH domain, DD [81312] (9 proteins)
    Pfam PF00531
  6. 2718979Protein automated matches [190466] (3 species)
    not a true protein
  7. 2718994Species Mouse (Mus musculus) [TaxId:10090] [187386] (1 PDB entry)
  8. 2718995Domain d2a9ia_: 2a9i A: [162730]
    automated match to d1wh4a_
    complexed with mn

Details for d2a9ia_

PDB Entry: 2a9i (more details), 1.7 Å

PDB Description: Molecular Structure of the Interleukin-1 Receptor-Associated Kinase-4 Death Domain
PDB Compounds: (A:) Interleukin-1 receptor-associated kinase-4

SCOPe Domain Sequences for d2a9ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a9ia_ a.77.1.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kpltpstyirnlnvgilrklsdfidpqegwkklavaikkpsgddrynqfhirrfeallqt
glsptcellfdwgttnctvgdlvdllvqielfapatlllpdavpq

SCOPe Domain Coordinates for d2a9ia_:

Click to download the PDB-style file with coordinates for d2a9ia_.
(The format of our PDB-style files is described here.)

Timeline for d2a9ia_: