Lineage for d1cuka1 (1cuk A:156-203)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1984734Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1984735Superfamily a.5.1: DNA helicase RuvA subunit, C-terminal domain [46929] (1 family) (S)
    possibly related to UBA-like domains
  5. 1984736Family a.5.1.1: DNA helicase RuvA subunit, C-terminal domain [46930] (1 protein)
  6. 1984737Protein DNA helicase RuvA subunit, C-terminal domain [46931] (3 species)
    tetramer; binds Holliday junction
  7. 1984738Species Escherichia coli [TaxId:562] [46932] (4 PDB entries)
  8. 1984739Domain d1cuka1: 1cuk A:156-203 [16273]
    Other proteins in same PDB: d1cuka2, d1cuka3

Details for d1cuka1

PDB Entry: 1cuk (more details), 1.9 Å

PDB Description: escherichia coli ruva protein at ph 4.9 and room temperature
PDB Compounds: (A:) ruva protein

SCOPe Domain Sequences for d1cuka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cuka1 a.5.1.1 (A:156-203) DNA helicase RuvA subunit, C-terminal domain {Escherichia coli [TaxId: 562]}
tddaeqeavarlvalgykpqeasrmvskiarpdassetlirealraal

SCOPe Domain Coordinates for d1cuka1:

Click to download the PDB-style file with coordinates for d1cuka1.
(The format of our PDB-style files is described here.)

Timeline for d1cuka1: