| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.53: Resolvase-like [53040] (2 superfamilies) Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest |
Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) ![]() |
| Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (2 proteins) |
| Protein automated matches [190278] (5 species) not a true protein |
| Species Haemophilus influenzae [TaxId:727] [187384] (14 PDB entries) |
| Domain d2a8ce_: 2a8c E: [162707] automated match to d1i6ob_ complexed with so4, zn |
PDB Entry: 2a8c (more details), 2.3 Å
SCOPe Domain Sequences for d2a8ce_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a8ce_ c.53.2.1 (E:) automated matches {Haemophilus influenzae [TaxId: 727]}
mdkikqlfannyswaqrmkeenstyfkeladhqtphylwigcsdsrvpaekltnlepgel
fvhrnvanqvihtdfnclsvvqyavdvlkiehiiicghtncggihaamadkdlglinnwl
lhirdiwfkhghllgklspekradmltkinvaeqvynlgrtsivksawergqklslhgwv
ydvndgflvdqgvmatsretleisyrnaiarlsildeeni
Timeline for d2a8ce_: