Lineage for d2a72a1 (2a72 A:320-450)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332890Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2332891Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2332952Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. 2332953Protein automated matches [190464] (3 species)
    not a true protein
  7. 2332962Species Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries)
  8. 2332964Domain d2a72a1: 2a72 A:320-450 [162700]
    Other proteins in same PDB: d2a72a2, d2a72b2
    automated match to d1fqia_
    complexed with cl

Details for d2a72a1

PDB Entry: 2a72 (more details), 2 Å

PDB Description: structure of the regulator of g-protein signaling domain of rgs7
PDB Compounds: (A:) Regulator of G-protein signalling 7

SCOPe Domain Sequences for d2a72a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a72a1 a.91.1.0 (A:320-450) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kepsqqrvkrwgfgmdealkdpvgreqflkflesefssenlrfwlavedlkkrpikevps
rvqeiwqeflapgapsainldsksydktthnvkepgrytfedaqehiyklmksdsyprfi
rssayqellqa

SCOPe Domain Coordinates for d2a72a1:

Click to download the PDB-style file with coordinates for d2a72a1.
(The format of our PDB-style files is described here.)

Timeline for d2a72a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a72a2