Lineage for d2a72a_ (2a72 A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
multihelical; consists of two all-alpha subdomains
contains a 4-helical bundle with left-handed twist and up-and-down topologySuperfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) 
Family a.91.1.0: automated matches [191379] (1 protein)
not a true familyProtein automated matches [190464] (2 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187381] (25 PDB entries) 
Domain d2a72a_: 2a72 A: [162700]
automated match to d1fqia_
complexed with cl
Details for d2a72a_
PDB Entry: 2a72 (more details), 2 Å
PDB Description: structure of the regulator of g-protein signaling domain of rgs7
PDB Compounds: (A:) Regulator of G-protein signalling 7SCOPe Domain Sequences for d2a72a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a72a_ a.91.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smkepsqqrvkrwgfgmdealkdpvgreqflkflesefssenlrfwlavedlkkrpikev
psrvqeiwqeflapgapsainldsksydktthnvkepgrytfedaqehiyklmksdsypr
firssayqellqa
SCOPe Domain Coordinates for d2a72a_:
Click to download the PDB-style file with coordinates for d2a72a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2a72a_:
- d2a72a_ first appeared in SCOPe 2.01
- d2a72a_ appears in SCOPe 2.04
- d2a72a_ is called d2a72a1 in SCOPe 2.06
- d2a72a_ appears in the current release, SCOPe 2.08, called d2a72a1
View in 3D
