SCOPe 2.08: Domain d2a72a1: 2a72 A:320-450

Lineage for d2a72a1 (2a72 A:320-450)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.0: automated matches [191379] (1 protein)
   not a true family

6. Protein automated matches [190464] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries)

8. Domain d2a72a1: 2a72 A:320-450 [162700]
   Other proteins in same PDB: d2a72a2, d2a72b2
   automated match to d1fqia_
   complexed with cl

Details for d2a72a1

PDB Entry: 2a72, 2 Å

PDB Description: structure of the regulator of g-protein signaling domain of rgs7

PDB Compounds: (A:) Regulator of G-protein signalling 7

SCOPe Domain Sequences for d2a72a1:

Sequence; same for both SEQRES and ATOM records:

>d2a72a1 a.91.1.0 (A:320-450) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kepsqqrvkrwgfgmdealkdpvgreqflkflesefssenlrfwlavedlkkrpikevps
rvqeiwqeflapgapsainldsksydktthnvkepgrytfedaqehiyklmksdsyprfi
rssayqellqa

Timeline for d2a72a1:

• d2a72a1 first appeared in SCOPe 2.01, called d2a72a_
  
• d2a72a1 appears in SCOPe 2.07