Lineage for d2a66a_ (2a66 A:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065411Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1065412Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1065949Family g.39.1.0: automated matches [191378] (1 protein)
    not a true family
  6. 1065950Protein automated matches [190463] (1 species)
    not a true protein
  7. 1065951Species Human (Homo sapiens) [TaxId:9606] [187379] (1 PDB entry)
  8. 1065952Domain d2a66a_: 2a66 A: [162699]
    automated match to d1lo1a_
    protein/DNA complex; complexed with act, zn

Details for d2a66a_

PDB Entry: 2a66 (more details), 2.2 Å

PDB Description: human liver receptor homologue dna-binding domain (hlrh-1 dbd) in complex with dsdna from the hcyp7a1 promoter
PDB Compounds: (A:) Orphan nuclear receptor NR5A2

SCOPe Domain Sequences for d2a66a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a66a_ g.39.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elcpvcgdkvsgyhyglltcesckgffkrtvqnnkrytcienqncqidktqrkrcpycrf
qkclsvgmkleavradrmrggrnkfgpmykrdral

SCOPe Domain Coordinates for d2a66a_:

Click to download the PDB-style file with coordinates for d2a66a_.
(The format of our PDB-style files is described here.)

Timeline for d2a66a_: