![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
![]() | Family g.39.1.0: automated matches [191378] (1 protein) not a true family |
![]() | Protein automated matches [190463] (9 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187379] (11 PDB entries) |
![]() | Domain d2a66a_: 2a66 A: [162699] automated match to d1lo1a_ protein/DNA complex; complexed with act, zn |
PDB Entry: 2a66 (more details), 2.2 Å
SCOPe Domain Sequences for d2a66a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a66a_ g.39.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} elcpvcgdkvsgyhyglltcesckgffkrtvqnnkrytcienqncqidktqrkrcpycrf qkclsvgmkleavradrmrggrnkfgpmykrdral
Timeline for d2a66a_: