SCOPe 2.05: Domain d2a5ia_: 2a5i A:

Lineage for d2a5ia_ (2a5i A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)

6. Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (6 species)
   contains an extra alpha-helical domain

7. Species SARS coronavirus [TaxId:227859] [89349] (65 PDB entries)

8. Domain d2a5ia_: 2a5i A: [162693]
   automated match to d1uj1b_
   complexed with azp, edo, gol

Details for d2a5ia_

PDB Entry: 2a5i, 1.88 Å

PDB Description: Crystal structures of SARS coronavirus main peptidase inhibited by an aza-peptide epoxide in the space group C2

PDB Compounds: (A:) 3C-like peptidase

SCOPe Domain Sequences for d2a5ia_:

Sequence; same for both SEQRES and ATOM records:

>d2a5ia_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
sgvtfq

Timeline for d2a5ia_:

• d2a5ia_ first appeared in SCOPe 2.01
  
• d2a5ia_ appears in SCOPe 2.04
  
• d2a5ia_ appears in SCOPe 2.06
  
• d2a5ia_ appears in the current release, SCOPe 2.08