Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.16: Lumazine synthase [52120] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.16.1: Lumazine synthase [52121] (1 family) |
Family c.16.1.1: Lumazine synthase [52122] (2 proteins) |
Protein automated matches [190461] (4 species) not a true protein |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [187376] (3 PDB entries) |
Domain d2a59d_: 2a59 D: [162690] automated match to d1kyve_ complexed with lmz, po4; mutant |
PDB Entry: 2a59 (more details), 2.7 Å
SCOPe Domain Sequences for d2a59d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a59d_ c.16.1.1 (D:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} lkgpelrilivharynlqaieplvkgavetmiekhdvklenidiesvpgswelpqgiras iarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilglltvlneeqaly raglngghnhgndwgsaavemglkal
Timeline for d2a59d_:
View in 3D Domains from other chains: (mouse over for more information) d2a59a_, d2a59b_, d2a59c_, d2a59e_ |