Lineage for d2a59a_ (2a59 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2462833Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2462834Superfamily c.16.1: Lumazine synthase [52121] (2 families) (S)
  5. 2462835Family c.16.1.1: Lumazine synthase [52122] (2 proteins)
  6. 2462994Protein automated matches [190461] (5 species)
    not a true protein
  7. 2463022Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [187376] (3 PDB entries)
  8. 2463023Domain d2a59a_: 2a59 A: [162687]
    automated match to d1kyve_
    complexed with lmz, po4; mutant

Details for d2a59a_

PDB Entry: 2a59 (more details), 2.7 Å

PDB Description: structure of 6,7-dimethyl-8-ribityllumazine synthase from schizosaccharomyces pombe mutant w27y with bound ligand 5-nitroso-6- ribitylamino-2,4(1h,3h)-pyrimidinedione
PDB Compounds: (A:) 6,7-dimethyl-8-ribityllumazine synthase

SCOPe Domain Sequences for d2a59a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a59a_ c.16.1.1 (A:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
lkgpelrilivharynlqaieplvkgavetmiekhdvklenidiesvpgswelpqgiras
iarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilglltvlneeqaly
raglngghnhgndwgsaavemglkal

SCOPe Domain Coordinates for d2a59a_:

Click to download the PDB-style file with coordinates for d2a59a_.
(The format of our PDB-style files is described here.)

Timeline for d2a59a_: