Lineage for d2a58e_ (2a58 E:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 981532Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 981533Superfamily c.16.1: Lumazine synthase [52121] (1 family) (S)
  5. 981534Family c.16.1.1: Lumazine synthase [52122] (2 proteins)
  6. 981683Protein automated matches [190461] (4 species)
    not a true protein
  7. 981690Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [187376] (3 PDB entries)
  8. 981705Domain d2a58e_: 2a58 E: [162686]
    automated match to d1kyve_
    complexed with po4, rbf; mutant

Details for d2a58e_

PDB Entry: 2a58 (more details), 2.8 Å

PDB Description: structure of 6,7-dimethyl-8-ribityllumazine synthase from schizosaccharomyces pombe mutant w27y with bound riboflavin
PDB Compounds: (E:) 6,7-dimethyl-8-ribityllumazine synthase

SCOPe Domain Sequences for d2a58e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a58e_ c.16.1.1 (E:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
lkgpelrilivharynlqaieplvkgavetmiekhdvklenidiesvpgswelpqgiras
iarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilglltvlneeqaly
raglngghnhgndwgsaavemglkal

SCOPe Domain Coordinates for d2a58e_:

Click to download the PDB-style file with coordinates for d2a58e_.
(The format of our PDB-style files is described here.)

Timeline for d2a58e_: