Lineage for d2a57d_ (2a57 D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1836882Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1836883Superfamily c.16.1: Lumazine synthase [52121] (2 families) (S)
  5. 1836884Family c.16.1.1: Lumazine synthase [52122] (2 proteins)
  6. 1837043Protein automated matches [190461] (5 species)
    not a true protein
  7. 1837061Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [187376] (3 PDB entries)
  8. 1837070Domain d2a57d_: 2a57 D: [162680]
    automated match to d1kyve_
    complexed with crm, po4; mutant

Details for d2a57d_

PDB Entry: 2a57 (more details), 2.75 Å

PDB Description: structure of 6,7-dimthyl-8-ribityllumazine synthase from schizosaccharomyces pombe mutant w27y with bound ligand 6- carboxyethyl-7-oxo-8-ribityllumazine
PDB Compounds: (D:) 6,7-dimethyl-8-ribityllumazine synthase

SCOPe Domain Sequences for d2a57d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a57d_ c.16.1.1 (D:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
lkgpelrilivharynlqaieplvkgavetmiekhdvklenidiesvpgswelpqgiras
iarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilglltvlneeqaly
raglngghnhgndwgsaavemglkal

SCOPe Domain Coordinates for d2a57d_:

Click to download the PDB-style file with coordinates for d2a57d_.
(The format of our PDB-style files is described here.)

Timeline for d2a57d_: