Lineage for d1wjfb_ (1wjf B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1984450Superfamily a.4.10: N-terminal Zn binding domain of HIV integrase [46919] (1 family) (S)
  5. 1984451Family a.4.10.1: N-terminal Zn binding domain of HIV integrase [46920] (1 protein)
    Zn-binding site is near the C-terminus
  6. 1984452Protein N-terminal Zn binding domain of HIV integrase [46921] (2 species)
  7. 1984453Species Human immunodeficiency virus type 1 [TaxId:11676] [46922] (7 PDB entries)
  8. 1984459Domain d1wjfb_: 1wjf B: [16268]
    complexed with cd; mutant

Details for d1wjfb_

PDB Entry: 1wjf (more details)

PDB Description: solution structure of h12c mutant of the n-terminal zn binding domain of hiv-1 integrase complexed to cadmium, nmr, 40 structures
PDB Compounds: (B:) hiv-1 integrase

SCOPe Domain Sequences for d1wjfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjfb_ a.4.10.1 (B:) N-terminal Zn binding domain of HIV integrase {Human immunodeficiency virus type 1 [TaxId: 11676]}
fldgidkaqeecekyhsnwramasdfnlppvvakeivascdkcqlkgeamhgqvd

SCOPe Domain Coordinates for d1wjfb_:

Click to download the PDB-style file with coordinates for d1wjfb_.
(The format of our PDB-style files is described here.)

Timeline for d1wjfb_: