Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.16: Lumazine synthase [52120] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.16.1: Lumazine synthase [52121] (2 families) |
Family c.16.1.1: Lumazine synthase [52122] (2 proteins) |
Protein automated matches [190461] (5 species) not a true protein |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [187376] (3 PDB entries) |
Domain d2a57a_: 2a57 A: [162677] automated match to d1kyve_ complexed with crm, po4; mutant |
PDB Entry: 2a57 (more details), 2.75 Å
SCOPe Domain Sequences for d2a57a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a57a_ c.16.1.1 (A:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} lkgpelrilivharynlqaieplvkgavetmiekhdvklenidiesvpgswelpqgiras iarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilglltvlneeqaly raglngghnhgndwgsaavemglkal
Timeline for d2a57a_:
View in 3D Domains from other chains: (mouse over for more information) d2a57b_, d2a57c_, d2a57d_, d2a57e_ |