Lineage for d2a4ma_ (2a4m A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2860902Species Deinococcus radiodurans [TaxId:1299] [187374] (2 PDB entries)
  8. 2860903Domain d2a4ma_: 2a4m A: [162674]
    automated match to d1i6ka_
    complexed with trp

Details for d2a4ma_

PDB Entry: 2a4m (more details), 2.3 Å

PDB Description: structure of trprs ii bound to atp
PDB Compounds: (A:) Tryptophanyl-tRNA synthetase II

SCOPe Domain Sequences for d2a4ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a4ma_ c.26.1.0 (A:) automated matches {Deinococcus radiodurans [TaxId: 1299]}
arprvltgdrptgalhlghlagslqnrvrlqdeaelfvlladvqaltdhfdrpeqvrenv
lavaldylaagldpqkttcvvqsavpelaeltvyflnlvtvshlrqnptvkaeiaqkgyg
ervpagffvypvsqaadiaafgatlvpvgddqlpmleqtreivrrfnalyapvlaepqaq
lsrvprlpgldgqakmskslgnaialgdsadevarkvmgmytdpghlrasdpgrvegnpv
ftfldafdpdparvqalkdqyragglgdvkvkkhlidvlngvlapirtrraeyerdpdav
lrfvtegtargrevaaqtlgqvrramrlfgh

SCOPe Domain Coordinates for d2a4ma_:

Click to download the PDB-style file with coordinates for d2a4ma_.
(The format of our PDB-style files is described here.)

Timeline for d2a4ma_: