![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.6: Cadherin-like [49313] (4 families) ![]() |
![]() | Family b.1.6.0: automated matches [191376] (1 protein) not a true family |
![]() | Protein automated matches [190458] (4 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [187373] (16 PDB entries) |
![]() | Domain d2a4cb1: 2a4c B:1-98 [162673] Other proteins in same PDB: d2a4ca2, d2a4cb2 automated match to d1o6sb_ |
PDB Entry: 2a4c (more details), 2.9 Å
SCOPe Domain Sequences for d2a4cb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a4cb1 b.1.6.0 (B:1-98) automated matches {Mouse (Mus musculus) [TaxId: 10090]} gwvwnqffvieeytgpdpvlvgrlhsdidsgdgnikyilsgegagtifviddksgnihat ktldreeraqytlmaqavdrdtnrpleppsefivkvqd
Timeline for d2a4cb1: