Lineage for d2a48a_ (2a48 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164731Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2164732Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2165335Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2165336Protein automated matches [190526] (21 species)
    not a true protein
  7. 2165348Species Anemonia majano [TaxId:105399] [188526] (3 PDB entries)
  8. 2165351Domain d2a48a_: 2a48 A: [162671]
    automated match to d1mova_
    complexed with bme

Details for d2a48a_

PDB Entry: 2a48 (more details), 2 Å

PDB Description: crystal structure of amfp486 e150q
PDB Compounds: (A:) GFP-like fluorescent chromoprotein amFP486

SCOPe Domain Sequences for d2a48a_:

Sequence, based on SEQRES records: (download)

>d2a48a_ d.22.1.0 (A:) automated matches {Anemonia majano [TaxId: 105399]}
igddmkmtyhmdgcvnghyftvkgegngkpyegtqtstfkvtmanggplafsfdilstvf
kygnrcftayptsmpdyfkqafpdgmsyertftyedggvatasweislkgncfehkstfh
gvnfpadgpvmakkttgwdpsfqkmtvcdgilkgdvtaflmlqgggnyrcqfhtsyktkk
pvtmppnhvvehriartdldkggnsvqltehavahit

Sequence, based on observed residues (ATOM records): (download)

>d2a48a_ d.22.1.0 (A:) automated matches {Anemonia majano [TaxId: 105399]}
igddmkmtyhmdgcvnghyftvkgegngkpyegtqtstfkvtmanggplafsfdilstvf
kygnrcftayptsmpdyfkqafgmsyertftyedggvatasweislkgncfehkstfhgv
nfpadgpvmakkttgwdpsfqkmtvcdgilkgdvtaflmlqgggnyrcqfhtsyktkkpv
tmppnhvvehriartdldkggnsvqltehavahit

SCOPe Domain Coordinates for d2a48a_:

Click to download the PDB-style file with coordinates for d2a48a_.
(The format of our PDB-style files is described here.)

Timeline for d2a48a_: