Lineage for d1wjfa_ (1wjf A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1742Superfamily a.4.10: N-terminal Zn binding domain of HIV integrase [46919] (1 family) (S)
  5. 1743Family a.4.10.1: N-terminal Zn binding domain of HIV integrase [46920] (1 protein)
  6. 1744Protein N-terminal Zn binding domain of HIV integrase [46921] (2 species)
  7. 1745Species Human immunodeficiency virus type 1 [TaxId:11676] [46922] (6 PDB entries)
  8. 1754Domain d1wjfa_: 1wjf A: [16267]

Details for d1wjfa_

PDB Entry: 1wjf (more details)

PDB Description: solution structure of h12c mutant of the n-terminal zn binding domain of hiv-1 integrase complexed to cadmium, nmr, 40 structures

SCOP Domain Sequences for d1wjfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjfa_ a.4.10.1 (A:) N-terminal Zn binding domain of HIV integrase {Human immunodeficiency virus type 1}
fldgidkaqeecekyhsnwramasdfnlppvvakeivascdkcqlkgeamhgqvd

SCOP Domain Coordinates for d1wjfa_:

Click to download the PDB-style file with coordinates for d1wjfa_.
(The format of our PDB-style files is described here.)

Timeline for d1wjfa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wjfb_