Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) |
Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
Protein Fibrinogen alpha chain [88887] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88889] (22 PDB entries) Uniprot P02671 150-209 |
Domain d2a45j_: 2a45 J: [162666] Other proteins in same PDB: d2a45.1, d2a45.2, d2a45h_, d2a45i_, d2a45k_, d2a45l_ central region only complexed with 0g6, po4 |
PDB Entry: 2a45 (more details), 3.65 Å
SCOPe Domain Sequences for d2a45j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a45j_ h.1.8.1 (J:) Fibrinogen alpha chain {Human (Homo sapiens) [TaxId: 9606]} sackdsdwpfcsdedwnykcpsgcrmkglidevnqdftnrinklknsl
Timeline for d2a45j_: