Lineage for d2a45i_ (2a45 I:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039948Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) (S)
  5. 3039949Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 3040061Protein Fibrinogen gamma chain [88898] (4 species)
  7. 3040070Species Human (Homo sapiens) [TaxId:9606] [88900] (18 PDB entries)
    Uniprot P02679
  8. 3040100Domain d2a45i_: 2a45 I: [162665]
    Other proteins in same PDB: d2a45.1, d2a45.2, d2a45g_, d2a45h_, d2a45j_, d2a45k_
    central region only
    complexed with 0g6, po4

Details for d2a45i_

PDB Entry: 2a45 (more details), 3.65 Å

PDB Description: crystal structure of the complex between thrombin and the central "e" region of fibrin
PDB Compounds: (I:) Fibrinogen gamma chain

SCOPe Domain Sequences for d2a45i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a45i_ h.1.8.1 (I:) Fibrinogen gamma chain {Human (Homo sapiens) [TaxId: 9606]}
dnccilderfgsycpttcgiadflstyqtkvdkdlqsled

SCOPe Domain Coordinates for d2a45i_:

Click to download the PDB-style file with coordinates for d2a45i_.
(The format of our PDB-style files is described here.)

Timeline for d2a45i_: