SCOPe 2.08: Domain d2a45i_: 2a45 I:

Lineage for d2a45i_ (2a45 I:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen gamma chain [88898] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88900] (18 PDB entries)
   Uniprot P02679

8. Domain d2a45i_: 2a45 I: [162665]
   Other proteins in same PDB: d2a45.1, d2a45.2, d2a45g_, d2a45h_, d2a45j_, d2a45k_
   central region only
   complexed with 0g6, po4

Details for d2a45i_

PDB Entry: 2a45, 3.65 Å

PDB Description: crystal structure of the complex between thrombin and the central "e" region of fibrin

PDB Compounds: (I:) Fibrinogen gamma chain

SCOPe Domain Sequences for d2a45i_:

Sequence; same for both SEQRES and ATOM records:

>d2a45i_ h.1.8.1 (I:) Fibrinogen gamma chain {Human (Homo sapiens) [TaxId: 9606]}
dnccilderfgsycpttcgiadflstyqtkvdkdlqsled

Timeline for d2a45i_:

• d2a45i_ first appeared in SCOPe 2.01
  
• d2a45i_ appears in SCOPe 2.07