Lineage for d2a45g_ (2a45 G:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039948Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) (S)
  5. 3039949Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 3039950Protein Fibrinogen alpha chain [88887] (4 species)
  7. 3039959Species Human (Homo sapiens) [TaxId:9606] [88889] (22 PDB entries)
    Uniprot P02671 150-209
  8. 3040003Domain d2a45g_: 2a45 G: [162663]
    Other proteins in same PDB: d2a45.1, d2a45.2, d2a45h_, d2a45i_, d2a45k_, d2a45l_
    central region only
    complexed with 0g6, po4

Details for d2a45g_

PDB Entry: 2a45 (more details), 3.65 Å

PDB Description: crystal structure of the complex between thrombin and the central "e" region of fibrin
PDB Compounds: (G:) fibrinogen alpha chain

SCOPe Domain Sequences for d2a45g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a45g_ h.1.8.1 (G:) Fibrinogen alpha chain {Human (Homo sapiens) [TaxId: 9606]}
sackdsdwpfcsdedwnykcpsgcrmkglidevnqdftnrinklknsl

SCOPe Domain Coordinates for d2a45g_:

Click to download the PDB-style file with coordinates for d2a45g_.
(The format of our PDB-style files is described here.)

Timeline for d2a45g_: