Lineage for d2a45.2 (2a45 D:,E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795761Protein Thrombin [50531] (2 species)
  7. 2795797Species Human (Homo sapiens) [TaxId:9606] [50532] (171 PDB entries)
    Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620
  8. 2795992Domain d2a45.2: 2a45 D:,E: [162662]
    Other proteins in same PDB: d2a45g_, d2a45h_, d2a45i_, d2a45j_, d2a45k_, d2a45l_
    complexed with 0g6, po4

Details for d2a45.2

PDB Entry: 2a45 (more details), 3.65 Å

PDB Description: crystal structure of the complex between thrombin and the central "e" region of fibrin
PDB Compounds: (D:) Thrombin light chain, (E:) Thrombin heavy chain

SCOPe Domain Sequences for d2a45.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g2a45.2 b.47.1.2 (D:,E:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
geadcglrplfekksledkterellesyidgrXivegsdaeigmspwqvmlfrkspqell
cgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyih
prynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlket
wtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsgg
pfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfg

SCOPe Domain Coordinates for d2a45.2:

Click to download the PDB-style file with coordinates for d2a45.2.
(The format of our PDB-style files is described here.)

Timeline for d2a45.2: