![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein Thrombin [50531] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50532] (171 PDB entries) Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620 |
![]() | Domain d2a45.2: 2a45 D:,E: [162662] Other proteins in same PDB: d2a45g_, d2a45h_, d2a45i_, d2a45j_, d2a45k_, d2a45l_ complexed with 0g6, po4 |
PDB Entry: 2a45 (more details), 3.65 Å
SCOPe Domain Sequences for d2a45.2:
Sequence; same for both SEQRES and ATOM records: (download)
>g2a45.2 b.47.1.2 (D:,E:) Thrombin {Human (Homo sapiens) [TaxId: 9606]} geadcglrplfekksledkterellesyidgrXivegsdaeigmspwqvmlfrkspqell cgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyih prynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlket wtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsgg pfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfg
Timeline for d2a45.2: