SCOPe 2.05: Domain d2a2ka_: 2a2k A:

Lineage for d2a2ka_ (2a2k A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451

4. Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families)
   Pfam PF00581
   the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology

5. Family c.46.1.1: Cell cycle control phosphatase, catalytic domain [52822] (5 proteins)

6. Protein CDC25b [52825] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52826] (14 PDB entries)

8. Domain d2a2ka_: 2a2k A: [162658]
   automated match to d1cwra_
   complexed with cl, so4; mutant

Details for d2a2ka_

PDB Entry: 2a2k, 1.52 Å

PDB Description: crystal structure of an active site mutant, c473s, of cdc25b phosphatase catalytic domain

PDB Compounds: (A:) M-phase inducer phosphatase 2

SCOPe Domain Sequences for d2a2ka_:

Sequence, based on SEQRES records:

>d2a2ka_ c.46.1.1 (A:) CDC25b {Human (Homo sapiens) [TaxId: 9606]}
meligdyskafllqtvdgkhqdlkyispetmvalltgkfsnivdkfvivdcrypyeyegg
hiktavnlplerdaesfllkspiapcsldkrvilifhsefssergprmcrfirerdravn
dypslyypemyilkggykeffpqhpnfcepqdyrpmnheafkdelktfrlktrsw

Sequence, based on observed residues (ATOM records):

>d2a2ka_ c.46.1.1 (A:) CDC25b {Human (Homo sapiens) [TaxId: 9606]}
meligdyskafllqtvdgkhqdlkyispetmvalltgkfsnivdkfvivdcrypyeyegg
hiktavnlplerdaesfllkspiapkrvilifhsefssergprmcrfirerdravndyps
lyypemyilkggykeffpqhpnfcepqdyrpmnheafkdelktfrlktrsw

Timeline for d2a2ka_:

• d2a2ka_ first appeared in SCOPe 2.01
  
• d2a2ka_ appears in SCOPe 2.04
  
• d2a2ka_ appears in SCOPe 2.06
  
• d2a2ka_ appears in the current release, SCOPe 2.08